PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100098920021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 173aa    MW: 20314.6 Da    PI: 7.3053
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100098920021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.8e-2052107156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   r++ +++t +q++++e++F+++++p+a++r eL++ lgL+  q+k+WFqN+R+++k
  Ote100098920021|100098920021  52 RKRYHRHTLHQIQAMEAFFKECPHPDAKQRNELSHALGLEPLQIKFWFQNKRTQMK 107
                                   688899***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-2136110IPR009057Homeodomain-like
SuperFamilySSF466891.67E-1941109IPR009057Homeodomain-like
PROSITE profilePS5007116.22849109IPR001356Homeobox domain
SMARTSM003892.0E-1850113IPR001356Homeobox domain
CDDcd000865.17E-1552110No hitNo description
PfamPF000461.0E-1752107IPR001356Homeobox domain
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MRLPPKELGH MDADSNLSEG EEDRRIDDEE VDNKSSDEDA DVGSTGNRHQ KRKRYHRHTL  60
HQIQAMEAFF KECPHPDAKQ RNELSHALGL EPLQIKFWFQ NKRTQMKSKH EREQNKHLRA  120
ENEKLRSENM RYKEALTNAS CPACGRMAAI SDVSIDERQL RIENARLREE VKN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267734.11e-65PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X1
SwissprotQ6ZAR01e-63ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLV4W4615e-64V4W461_9R
STRINGVIT_12s0059g02310.t012e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13806913